| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
| Protein Glutamine-binding protein [53879] (1 species) |
| Species Escherichia coli [TaxId:562] [53880] (2 PDB entries) |
| Domain d1wdna_: 1wdn A: [35816] complexed with gln |
PDB Entry: 1wdn (more details), 1.94 Å
SCOPe Domain Sequences for d1wdna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]}
klvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvd
lalagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdy
akaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaq
qygiafpkgsdelrdkvngalktlrengtyneiykkwfgtepk
Timeline for d1wdna_: