Lineage for d1wdda2 (1wdd A:11-150)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909193Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1909194Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1909275Species Rice (Oryza sativa) [TaxId:4530] [117976] (3 PDB entries)
    Uniprot P12089
  8. 1909276Domain d1wdda2: 1wdd A:11-150 [114529]
    Other proteins in same PDB: d1wdda1, d1wdde1, d1wdds_, d1wddw_
    complexed with cap, gol, mg

Details for d1wdda2

PDB Entry: 1wdd (more details), 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1wdda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdda2 d.58.9.1 (A:11-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
vgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvw
tdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkal
ralrledlripptysktfqg

SCOPe Domain Coordinates for d1wdda2:

Click to download the PDB-style file with coordinates for d1wdda2.
(The format of our PDB-style files is described here.)

Timeline for d1wdda2:

1909276
d1wdda2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1wdda1