| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
| Species Rice (Oryza sativa) [TaxId:4530] [117976] (5 PDB entries) Uniprot P12089 |
| Domain d1wdda2: 1wdd A:11-150 [114529] Other proteins in same PDB: d1wdda1, d1wdde1, d1wdds_, d1wddw_ complexed with cap, gol, mg |
PDB Entry: 1wdd (more details), 1.35 Å
SCOPe Domain Sequences for d1wdda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdda2 d.58.9.1 (A:11-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
vgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvw
tdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkal
ralrledlripptysktfqg
Timeline for d1wdda2:
View in 3DDomains from other chains: (mouse over for more information) d1wdde1, d1wdde2, d1wdds_, d1wddw_ |