Lineage for d1wd3a2 (1wd3 A:338-499)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. Superfamily b.42.8: AbfB domain [110221] (2 families) (S)
    automatically mapped to Pfam PF05270
  5. Family b.42.8.1: AbfB domain [110222] (1 protein)
    Pfam PF05270
  6. Protein Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain [110223] (1 species)
  7. Species Aspergillus kawachii [TaxId:40384] [110224] (2 PDB entries)
    Uniprot Q8NK89 19-499
  8. Domain d1wd3a2: 1wd3 A:338-499 [109234]
    Other proteins in same PDB: d1wd3a1

Details for d1wd3a2

PDB Entry: 1wd3 (more details), 1.7500000000000002 Å

PDB Description: crystal structure of arabinofuranosidase
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d1wd3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd3a2 b.42.8.1 (A:338-499) Alpha-L-arabinofuranosidase B (AbfB), C-terminal domain {Aspergillus kawachii [TaxId: 40384]}
lvsgpsftsgevvslrvttpgyttryiahtdttvntqvvdddssttlkeeaswtvvtgla
nsqcfsfesvdtpgsyirhynfelllnandgtkqfhedatfcpqaalngegtslrswsyp
tryfrhyenvlyaasnggvqtfdsktsfnndvsfeietafas

SCOPe Domain Coordinates for d1wd3a2 are not available.

Timeline for d1wd3a2:

Domains from same chain:
(mouse over for more information)
d1wd3a1