Lineage for d1wc8a_ (1wc8 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741309Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 741310Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (2 families) (S)
  5. 741321Family d.278.1.2: TRAPP components [118076] (1 protein)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. 741322Protein Trafficking protein particle complex subunit 3, Bet3 homolog [118077] (1 species)
    covalently linked long fatty acid occupies the ligand-binding cavity
  7. 741323Species Mouse (Mus musculus) [TaxId:10090] [118078] (3 PDB entries)
  8. 741326Domain d1wc8a_: 1wc8 A: [114506]
    complexed with myr

Details for d1wc8a_

PDB Entry: 1wc8 (more details), 1.9 Å

PDB Description: the crystal structure of mouse bet3p
PDB Compounds: (A:) trafficking protein particle complex subunit3

SCOP Domain Sequences for d1wc8a_:

Sequence, based on SEQRES records: (download)

>d1wc8a_ d.278.1.2 (A:) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
teskkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrc
hdfretadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliys
nllcgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirried

Sequence, based on observed residues (ATOM records): (download)

>d1wc8a_ d.278.1.2 (A:) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
teskkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgch
dfretadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysn
llcgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirried

SCOP Domain Coordinates for d1wc8a_:

Click to download the PDB-style file with coordinates for d1wc8a_.
(The format of our PDB-style files is described here.)

Timeline for d1wc8a_: