Lineage for d1wc7b1 (1wc7 B:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510705Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (57 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1510758Domain d1wc7b1: 1wc7 B:1-113 [144550]
    Other proteins in same PDB: d1wc7a1, d1wc7a2, d1wc7b2, d1wc7h2, d1wc7l1, d1wc7l2
    complexed with iod, pp3

Details for d1wc7b1

PDB Entry: 1wc7 (more details), 2.33 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-l-alanine
PDB Compounds: (B:) fab fragment of catalytic antibody 15a9, heavy chain

SCOPe Domain Sequences for d1wc7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wc7b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
vtvss

SCOPe Domain Coordinates for d1wc7b1:

Click to download the PDB-style file with coordinates for d1wc7b1.
(The format of our PDB-style files is described here.)

Timeline for d1wc7b1: