![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
![]() | Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) ![]() |
![]() | Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein) |
![]() | Protein DNA repair protein MutS, domain III [48336] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [48338] (8 PDB entries) Uniprot P23909 2-800 |
![]() | Domain d1wb9a1: 1wb9 A:270-566 [120833] Other proteins in same PDB: d1wb9a2, d1wb9a3, d1wb9a4 automatically matched to d1e3ma1 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wb9 (more details), 2.1 Å
SCOPe Domain Sequences for d1wb9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1wb9a1: