Lineage for d1wa8b1 (1wa8 B:602-695)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) 
(hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
Family a.25.3.1: ESAT-6 like [140454] (3 proteins)
Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip
Protein ESAT-6, EsxA [140457] (1 species)
6 kDa early secretory antigenic targetSpecies Mycobacterium tuberculosis [TaxId:1773] [140458] (2 PDB entries)
Uniprot P0A564 1-94
Domain d1wa8b1: 1wa8 B:602-695 [120810]
Other proteins in same PDB: d1wa8a1
Details for d1wa8b1
PDB Entry: 1wa8 (more details)
PDB Description: solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria
PDB Compounds: (B:) 6 kda early secretory antigenic target (esat-6)SCOPe Domain Sequences for d1wa8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wa8b1 a.25.3.1 (B:602-695) ESAT-6, EsxA {Mycobacterium tuberculosis [TaxId: 1773]}
teqqwnfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwdat
atelnnalqnlartiseagqamastegnvtgmfa
SCOPe Domain Coordinates for d1wa8b1:
Click to download the PDB-style file with coordinates for d1wa8b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wa8b1:
- d1wa8b1 first appeared in SCOP 1.73
- d1wa8b1 appears in SCOPe 2.07
View in 3D
