Lineage for d1wa8a1 (1wa8 A:1-99)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
Superfamily a.25.3: EsxAB dimer-like [140453] (1 family) 
(hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metalsFamily a.25.3.1: ESAT-6 like [140454] (3 proteins)
Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip
Protein ESAT-6 like protein EsxB [140455] (1 species) Species Mycobacterium tuberculosis [TaxId:1773] [140456] (1 PDB entry)
Uniprot P0A566 1-99
Domain d1wa8a1: 1wa8 A:1-99 [120809]
Other proteins in same PDB: d1wa8b1
Details for d1wa8a1
PDB Entry: 1wa8 (more details)
PDB Description: solution structure of the cfp-10.esat-6 complex. major virulence determinants of pathogenic mycobacteria
PDB Compounds: (A:) esat-6 like protein esxbSCOPe Domain Sequences for d1wa8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wa8a1 a.25.3.1 (A:1-99) ESAT-6 like protein EsxB {Mycobacterium tuberculosis [TaxId: 1773]}
aemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqea
ankqkqeldeistnirqagvqysradeeqqqalssqmgf
SCOPe Domain Coordinates for d1wa8a1:
Click to download the PDB-style file with coordinates for d1wa8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wa8a1:
- d1wa8a1 first appeared in SCOP 1.73
- d1wa8a1 appears in SCOP 1.75
- d1wa8a1 appears in SCOPe 2.02
- d1wa8a1 appears in the current release, SCOPe 2.08
View in 3D
