Lineage for d1w6ta2 (1w6t A:1-137)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
C-terminal domain is beta/alpha-barrel
Protein Enolase [54828] (9 species) 
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143247] (1 PDB entry)
Uniprot Q8DPS0 1-137
Domain d1w6ta2: 1w6t A:1-137 [120671]
Other proteins in same PDB: d1w6ta1, d1w6tb1
complexed with 2pe, mg
Details for d1w6ta2
PDB Entry: 1w6t (more details), 2.1 Å
PDB Description: crystal structure of octameric enolase from streptococcus pneumoniae
PDB Compounds: (A:) enolaseSCOPe Domain Sequences for d1w6ta2:
Sequence, based on SEQRES records: (download)
>d1w6ta2 d.54.1.1 (A:1-137) Enolase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksryg
glgtqkavdnvnniiaeaiigydvrdqqaidramialdgtpnkgklganailgvsiavar
aaadyleiplysylggf
Sequence, based on observed residues (ATOM records): (download)
>d1w6ta2 d.54.1.1 (A:1-137) Enolase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
msiitdvyarevldsrgnptlevevytesgafgrgmvpsggeheavelrdgdksrygglg
tqkavdnvnniiaeaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dyleiplysylggf
SCOPe Domain Coordinates for d1w6ta2:
Click to download the PDB-style file with coordinates for d1w6ta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w6ta2:
- d1w6ta2 first appeared in SCOP 1.73
- d1w6ta2 appears in SCOPe 2.02
- d1w6ta2 appears in SCOPe 2.04
- d1w6ta2 appears in the current release, SCOPe 2.08
View in 3D
