Lineage for d1w6sb_ (1w6s B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733707Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2733708Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2733709Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. 2733710Species Methylobacterium extorquens [TaxId:408] [63633] (3 PDB entries)
    Uniprot P14775
  8. 2733711Domain d1w6sb_: 1w6s B: [114285]
    Other proteins in same PDB: d1w6sa_, d1w6sc_
    complexed with ca, gol, pqq

Details for d1w6sb_

PDB Entry: 1w6s (more details), 1.2 Å

PDB Description: the high resolution structure of methanol dehydrogenase from methylobacterium extorquens
PDB Compounds: (B:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d1w6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6sb_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylobacterium extorquens [TaxId: 408]}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakisa

SCOPe Domain Coordinates for d1w6sb_:

Click to download the PDB-style file with coordinates for d1w6sb_.
(The format of our PDB-style files is described here.)

Timeline for d1w6sb_: