Lineage for d1w5ba1 (1w5b A:23-231)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) Protein Cell-division protein FtsZ [52492] (9 species) 
Species Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries)
Uniprot Q57816 23-360
Domain d1w5ba1: 1w5b A:23-231 [114211]
Other proteins in same PDB: d1w5ba2, d1w5bb2
complexed with gtp
Details for d1w5ba1
PDB Entry: 1w5b (more details), 2.2 Å
PDB Description: ftsz dimer, gtp soak (m. jannaschii)
PDB Compounds: (A:) cell division protein ftsz homolog 1SCOPe Domain Sequences for d1w5ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5ba1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl
SCOPe Domain Coordinates for d1w5ba1:
Click to download the PDB-style file with coordinates for d1w5ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w5ba1:
- d1w5ba1 first appeared in SCOP 1.71
- d1w5ba1 appears in SCOPe 2.05
- d1w5ba1 appears in SCOPe 2.07
- d1w5ba1 appears in the current release, SCOPe 2.08
View in 3D
