Lineage for d1w4zb_ (1w4z B:)
- Root: SCOPe 2.02
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
Protein beta-keto acyl carrier protein reductase [51788] (8 species) 
Species Streptomyces coelicolor [TaxId:1902] [117408] (8 PDB entries)
Uniprot P16544 #SP
Domain d1w4zb_: 1w4z B: [114196]
complexed with fmt, nap
Details for d1w4zb_
PDB Entry: 1w4z (more details), 2.5 Å
PDB Description: structure of actinorhodin polyketide (actiii) reductase
PDB Compounds: (B:) ketoacyl reductaseSCOPe Domain Sequences for d1w4zb_:
Sequence, based on SEQRES records: (download)
>d1w4zb_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
lvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelrea
gveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvet
nltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalgl
elartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpseva
emvayligpgaaavtaqalnvcgglgny
Sequence, based on observed residues (ATOM records): (download)
>d1w4zb_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
lvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelrea
gveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvet
nltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalgl
elartgitvnavcpgfvetpmaasvrehyteeafdritarvpigryvqpsevaemvayli
gpgaaavtaqalnvcgglgny
SCOPe Domain Coordinates for d1w4zb_:
Click to download the PDB-style file with coordinates for d1w4zb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w4zb_:
- d1w4zb_ first appeared in SCOP 1.71
- d1w4zb_ appears in SCOPe 2.01
- d1w4zb_ appears in SCOPe 2.03
- d1w4zb_ appears in the current release, SCOPe 2.08, called d1w4zb1
View in 3D
