| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Protein Phenylacetone monooxygenase [110440] (1 species) |
| Species Thermobifida fusca [TaxId:2021] [110441] (6 PDB entries) Uniprot Q5YS95 # 55% sequence identity; Nocardia farcinica TaxID:37329 |
| Domain d1w4xa2: 1w4x A:155-389 [109172] complexed with fad, so4 |
PDB Entry: 1w4x (more details), 1.7 Å
SCOPe Domain Sequences for d1w4xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}
vpqlpnfpglkdfagnlyhtgnwphepvdfsgqrvgvigtgssgiqvspqiakqaaelfv
fqrtphfavparnapldpefladlkkryaefreesrntpggthryqgpksalevsdeelv
etlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfg
tkrlileidyyemfnrdnvhlvdtlsapietitprgvrtsereyeldslvlatgf
Timeline for d1w4xa2: