Lineage for d1w4xa2 (1w4x A:155-389)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109874Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2110118Protein Phenylacetone monooxygenase [110440] (1 species)
  7. 2110119Species Thermobifida fusca [TaxId:2021] [110441] (6 PDB entries)
    Uniprot Q5YS95 # 55% sequence identity; Nocardia farcinica TaxID:37329
  8. 2110121Domain d1w4xa2: 1w4x A:155-389 [109172]
    complexed with fad, so4

Details for d1w4xa2

PDB Entry: 1w4x (more details), 1.7 Å

PDB Description: phenylacetone monooxygenase, a baeyer-villiger monooxygenase
PDB Compounds: (A:) phenylacetone monooxygenase

SCOPe Domain Sequences for d1w4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}
vpqlpnfpglkdfagnlyhtgnwphepvdfsgqrvgvigtgssgiqvspqiakqaaelfv
fqrtphfavparnapldpefladlkkryaefreesrntpggthryqgpksalevsdeelv
etlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfg
tkrlileidyyemfnrdnvhlvdtlsapietitprgvrtsereyeldslvlatgf

SCOPe Domain Coordinates for d1w4xa2:

Click to download the PDB-style file with coordinates for d1w4xa2.
(The format of our PDB-style files is described here.)

Timeline for d1w4xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w4xa1