Lineage for d1w30a_ (1w30 A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the restSuperfamily c.61.1: PRTase-like [53271] (3 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) 
Protein Pyrimidine operon regulator PyrR [109612] (4 species)
bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
Species Mycobacterium tuberculosis [TaxId:1773] [117672] (1 PDB entry)
Uniprot P71807
Domain d1w30a_: 1w30 A: [114118]
Details for d1w30a_
PDB Entry: 1w30 (more details), 1.9 Å
PDB Description: pyrr of mycobacterium tuberculosis as a potential drug target
PDB Compounds: (A:) PyrR bifunctional proteinSCOPe Domain Sequences for d1w30a_:
Sequence, based on SEQRES records: (download)
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]}
esrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrddlmikpprplastsipaggiddalvilvddvlysgrsvrsa
ldalrdvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvi
sr
Sequence, based on observed residues (ATOM records): (download)
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]}
esrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrdplastsipaggiddalvilvddvlysgrsvrsaldalrdvg
rpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvisr
SCOPe Domain Coordinates for d1w30a_:
Click to download the PDB-style file with coordinates for d1w30a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w30a_:
- d1w30a_ first appeared in SCOP 1.71
- d1w30a_ appears in SCOPe 2.06
- d1w30a_ appears in the current release, SCOPe 2.08
View in 3D
