Lineage for d1w2ya_ (1w2y A:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramerSuperfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) 
basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
Family a.204.1.1: Type II deoxyuridine triphosphatase [101387] (1 protein)
one subunit comprises two degenerate structural repeats, organised into the "rigid" and "mobile" subdomainsProtein Type II deoxyuridine triphosphatase [101388] (2 species) Species Campylobacter jejuni [TaxId:197] [109960] (2 PDB entries) 
Domain d1w2ya_: 1w2y A: [109140]
Details for d1w2ya_
PDB Entry: 1w2y (more details), 1.65 Å
PDB Description: the crystal structure of a complex of campylobacter jejuni dutpase with substrate analogue dupnhp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotide hydrolaseSCOP Domain Sequences for d1w2ya_:
Sequence, based on SEQRES records: (download)
>d1w2ya_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka
Sequence, based on observed residues (ATOM records): (download)
>d1w2ya_ a.204.1.1 (A:) Type II deoxyuridine triphosphatase {Campylobacter jejuni [TaxId: 197]}
mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
nissltnwenvrieivdiwhfilsllleeynnkdfkaiatevnavsvfqdfckeeeypne
gdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrq
nngykdgsykktwngkednevlaqileqeldfdtiykkleecykka
SCOP Domain Coordinates for d1w2ya_:
Click to download the PDB-style file with coordinates for d1w2ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w2ya_:
- d1w2ya_ first appeared in SCOP 1.69
- d1w2ya_ appears in SCOP 1.71
- d1w2ya_ appears in SCOP 1.75
- d1w2ya_ appears in the current release, SCOPe 2.08
View in 3D
