Lineage for d1w2ca_ (1w2c A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.143.1: SAICAR synthase-like [56104] (4 families) 
shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins)
Pfam PF03770Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species) Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries)
Uniprot P23677 187-461
Domain d1w2ca_: 1w2c A: [109119]
complexed with anp, i3p, mn, so4
Details for d1w2ca_
PDB Entry: 1w2c (more details), 1.95 Å
PDB Description: human inositol (1,4,5) trisphosphate 3-kinase complexed with mn2+/amppnp/ins(1,4,5)p3
PDB Compounds: (A:) inositol-trisphosphate 3-kinase aSCOPe Domain Sequences for d1w2ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ca_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]}
sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym
qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr
lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe
egnredgyllgldnligilaslaer
SCOPe Domain Coordinates for d1w2ca_:
Click to download the PDB-style file with coordinates for d1w2ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w2ca_:
- d1w2ca_ first appeared in SCOP 1.69
- d1w2ca_ appears in SCOPe 2.07
View in 3D
