Lineage for d1w23a_ (1w23 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896214Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 2896215Species Bacillus alcalophilus [TaxId:1445] [117697] (12 PDB entries)
    Uniprot Q9RME2
  8. 2896216Domain d1w23a_: 1w23 A: [114088]
    complexed with cl, epe, gol, mg, peg, pge, plp

Details for d1w23a_

PDB Entry: 1w23 (more details), 1.08 Å

PDB Description: crystal structure of phosphoserine aminotransferase from bacillus alcalophilus
PDB Compounds: (A:) phosphoserine aminotransferase

SCOPe Domain Sequences for d1w23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
plkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpp
tfsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvt
fnlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

SCOPe Domain Coordinates for d1w23a_:

Click to download the PDB-style file with coordinates for d1w23a_.
(The format of our PDB-style files is described here.)

Timeline for d1w23a_: