Lineage for d1w1b1_ (1w1b 1:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) 
in the different families beta-barrels are similarly distorted but may vary in the number of strands
Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
Protein automated matches [190086] (3 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [186808] (3 PDB entries) 
Domain d1w1b1_: 1w1b 1: [120577]
automated match to d1ny1a_
complexed with cd
Details for d1w1b1_
PDB Entry: 1w1b (more details), 2.1 Å
PDB Description: structure of bacillus subtilis pdaa with cadmium, a family 4 carbohydrate esterase.
PDB Compounds: (1:) Probable polysaccharide deacetylase pdaASCOPe Domain Sequences for d1w1b1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1b1_ c.6.2.3 (1:) automated matches {Bacillus subtilis [TaxId: 1423]}
vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk
vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel
dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk
yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemr
SCOPe Domain Coordinates for d1w1b1_:
Click to download the PDB-style file with coordinates for d1w1b1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w1b1_:
- d1w1b1_ first appeared in SCOP 1.73, called d1w1b11
- d1w1b1_ appears in SCOPe 2.07
View in 3D
