Class g: Small proteins [56992] (90 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (6 families) |
Family g.44.1.3: Variant RING domain [118300] (2 proteins) |
Protein IE1B protein (ORF K3), N-terminal domain [118301] (1 species) |
Species Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId:37296] [118302] (1 PDB entry) Uniprot P90495 1-60 |
Domain d1vyxa_: 1vyx A: [114033] complexed with zn |
PDB Entry: 1vyx (more details)
SCOP Domain Sequences for d1vyxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} mededvpvcwicneelgnerfracgctgelenvhrsclstwltisrntacqicgvvyntr
Timeline for d1vyxa_: