Lineage for d1vyxa_ (1vyx A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893809Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 893810Superfamily g.44.1: RING/U-box [57850] (6 families) (S)
  5. 893887Family g.44.1.3: Variant RING domain [118300] (2 proteins)
  6. 893888Protein IE1B protein (ORF K3), N-terminal domain [118301] (1 species)
  7. 893889Species Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId:37296] [118302] (1 PDB entry)
    Uniprot P90495 1-60
  8. 893890Domain d1vyxa_: 1vyx A: [114033]
    complexed with zn

Details for d1vyxa_

PDB Entry: 1vyx (more details)

PDB Description: solution structure of the kshv k3 n-terminal domain
PDB Compounds: (A:) orf k3

SCOP Domain Sequences for d1vyxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}
mededvpvcwicneelgnerfracgctgelenvhrsclstwltisrntacqicgvvyntr

SCOP Domain Coordinates for d1vyxa_:

Click to download the PDB-style file with coordinates for d1vyxa_.
(The format of our PDB-style files is described here.)

Timeline for d1vyxa_: