Lineage for d1vywb1 (1vyw B:175-309)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495405Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1495418Protein Cyclin A [47956] (2 species)
  7. 1495454Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
    Uniprot P20248 175-432
  8. 1495545Domain d1vywb1: 1vyw B:175-309 [108923]
    Other proteins in same PDB: d1vywa_, d1vywc_
    complexed with 292, so4

Details for d1vywb1

PDB Entry: 1vyw (more details), 2.3 Å

PDB Description: structure of cdk2/cyclin a with pnu-292137
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1vywb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vywb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d1vywb1:

Click to download the PDB-style file with coordinates for d1vywb1.
(The format of our PDB-style files is described here.)

Timeline for d1vywb1:

1495545
d1vywb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1vywb2