![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries) |
![]() | Domain d1vywa_: 1vyw A: [108922] Other proteins in same PDB: d1vywb1, d1vywb2, d1vywd1, d1vywd2 |
PDB Entry: 1vyw (more details), 2.3 Å
SCOP Domain Sequences for d1vywa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vywa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} plvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl rl
Timeline for d1vywa_: