Lineage for d1vrta1 (1vrt A:430-539)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) 
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) 
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
Domain d1vrta1: 1vrt A:430-539 [33574]
Other proteins in same PDB: d1vrta2, d1vrtb_
complexed with mg, nvp
Details for d1vrta1
PDB Entry: 1vrt (more details), 2.2 Å
PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes
PDB Compounds: (A:) hiv-1 reverse transcriptaseSCOPe Domain Sequences for d1vrta1:
Sequence, based on SEQRES records: (download)
>d1vrta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
Sequence, based on observed residues (ATOM records): (download)
>d1vrta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvpah
SCOPe Domain Coordinates for d1vrta1:
Click to download the PDB-style file with coordinates for d1vrta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vrta1:
- d1vrta1 first appeared (with stable ids) in SCOP 1.55
- d1vrta1 appears in SCOPe 2.07
View in 3D
