Lineage for d1vrga2 (1vrg A:252-515)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. Species Thermotoga maritima [TaxId:2336] [142011] (1 PDB entry)
    Uniprot Q9WZH5 1-251! Uniprot Q9WZH5 252-515
  8. Domain d1vrga2: 1vrg A:252-515 [120459]
    complexed with bct, mg

Details for d1vrga2

PDB Entry: 1vrg (more details), 2.3 Å

PDB Description: crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
PDB Compounds: (A:) propionyl-CoA carboxylase, beta subunit

SCOPe Domain Sequences for d1vrga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]}
aeeppvedpdtsletpedildilpdnpnkgydvrdvikrvvdhgeffevqpyfaknivig
fariqgktvgivanqpsvlagvldidssdkaarfirfldafnipiltfvdtpgylpgvaq
ehggiirhgakllyayseatvpkitvilrkayggayiamgskhlgadmvlawpsaeiavm
gpegaaniifkreieassnpeetrrklieeykqqfanpyiaasrgyvdmvidpretrkyi
mralevcetkveyrpkkkhgnipl

SCOPe Domain Coordinates for d1vrga2 are not available.

Timeline for d1vrga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vrga1
View in 3D
Domains from other chains:
(mouse over for more information)
d1vrgb1, d1vrgb2, d1vrgc1, d1vrgc2, d1vrgd1, d1vrgd2, d1vrge1, d1vrge2, d1vrgf1, d1vrgf2