Lineage for d1vr2a_ (1vr2 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221445Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1221446Species Human (Homo sapiens) [TaxId:9606] [56161] (20 PDB entries)
  8. 1221466Domain d1vr2a_: 1vr2 A: [41701]

Details for d1vr2a_

PDB Entry: 1vr2 (more details), 2.4 Å

PDB Description: human vascular endothelial growth factor receptor 2 (kdr) kinase domain
PDB Compounds: (A:) protein (vascular endothelial growth factor receptor kinase)

SCOPe Domain Sequences for d1vr2a_:

Sequence, based on SEQRES records: (download)

>d1vr2a_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqana

Sequence, based on observed residues (ATOM records): (download)

>d1vr2a_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
dfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfdarlplkwma
petifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttp
emyqtmldcwhgepsqrptfselvehlgnllqana

SCOPe Domain Coordinates for d1vr2a_:

Click to download the PDB-style file with coordinates for d1vr2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vr2a_: