Lineage for d1vqwa2 (1vqw A:181-287)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. Protein Flavin-dependent monoxygenase SPBP16F5.08c, middle domain [418941] (1 species)
  7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [419393] (3 PDB entries)
    Uniprot Q9HFE4
  8. Domain d1vqwa2: 1vqw A:181-287 [114029]
    Other proteins in same PDB: d1vqwa1, d1vqwb1
    Structural genomics target
    complexed with epe, fad

Details for d1vqwa2

PDB Entry: 1vqw (more details), 2.4 Å

PDB Description: crystal structure of a protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases
PDB Compounds: (A:) protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases

SCOPe Domain Sequences for d1vqwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqwa2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c, middle domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyc

SCOPe Domain Coordinates for d1vqwa2 are not available.

Timeline for d1vqwa2:

Domains from same chain:
(mouse over for more information)
d1vqwa1
Domains from other chains:
(mouse over for more information)
d1vqwb1, d1vqwb2