Lineage for d1vp6a_ (1vp6 A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Putative ion channel CnbD [110321] (1 species) Species Mesorhizobium loti [TaxId:381] [110322] (3 PDB entries)
Uniprot Q98GN8 218-350 # mll3241
Domain d1vp6a_: 1vp6 A: [113939]
complexed with br, cmp
Details for d1vp6a_
PDB Entry: 1vp6 (more details), 1.7 Å
PDB Description: M.loti ion channel cylic nucleotide binding domain
PDB Compounds: (A:) Cyclic-nucleotide binding domain of mesorhizobium loti CNG potassium channelSCOPe Domain Sequences for d1vp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg
SCOPe Domain Coordinates for d1vp6a_:
Click to download the PDB-style file with coordinates for d1vp6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vp6a_:
- d1vp6a_ first appeared in SCOP 1.71
- d1vp6a_ appears in SCOPe 2.07
View in 3D
