![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein 2,5-diketo-D-gluconic acid reductase A [51443] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [117365] (1 PDB entry) Uniprot Q9X0A2 |
![]() | Domain d1vp5a_: 1vp5 A: [113937] Structural genomics target complexed with nap |
PDB Entry: 1vp5 (more details), 2.4 Å
SCOPe Domain Sequences for d1vp5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} qvpkvtlnngvempilgygvfqippekteecvyeaikvgyrlidtaasymneegvgraik raidegivrreelfvttklwvsdvgyestkkafekslkklqleyidlylihqpfgdvhca wkameemykdglvraigvsnfypdrlmdlmvhheivpavnqieihpfyqrqeeiefmrny niqpeawgpfaegrknifqngvlrsiaekygktvaqvilrwltqkgivaipktvrrermk enisifdfeltqedmekiatldegqsaffshrdpevvkwicslk
Timeline for d1vp5a_: