Lineage for d1vp2a_ (1vp2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856374Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1856375Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
    Pfam PF01725
  6. 1856382Protein Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 [117615] (1 species)
  7. 1856383Species Thermotoga maritima [TaxId:2336] [117616] (2 PDB entries)
    Uniprot Q9WY06
  8. 1856384Domain d1vp2a_: 1vp2 A: [113933]
    Structural genomics target
    complexed with so4

Details for d1vp2a_

PDB Entry: 1vp2 (more details), 1.78 Å

PDB Description: crystal structure of a putative xanthosine triphosphate pyrophosphatase/ham1 protein homolog (tm0159) from thermotoga maritima at 1.78 a resolution
PDB Compounds: (A:) Putative Xanthosine triphosphate pyrophosphatase/HAM1 protein homolog

SCOPe Domain Sequences for d1vp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vp2a_ c.51.4.1 (A:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]}
kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh
pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp
ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk
lfsvlekil

SCOPe Domain Coordinates for d1vp2a_:

Click to download the PDB-style file with coordinates for d1vp2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vp2a_: