Lineage for d1vm0a_ (1vm0 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.68: IF3-like [55199] (8 superfamilies)
beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
Superfamily d.68.6: AlbA-like [82704] (3 families) 
Family d.68.6.2: Hypothetical protein At2g34160 [111027] (2 proteins) 
Protein Hypothetical protein At2g34160 [111028] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (1 PDB entry)
Uniprot O22969 19-117
Domain d1vm0a_: 1vm0 A: [108873]
Structural genomics target
complexed with k, no3
Details for d1vm0a_
PDB Entry: 1vm0 (more details), 1.8 Å
PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g34160
PDB Compounds: (A:) unknown proteinSCOPe Domain Sequences for d1vm0a_:
Sequence, based on SEQRES records: (download)
>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikddargrpvqkakieitlvksekfdelmaaa
Sequence, based on observed residues (ATOM records): (download)
>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikpvqkakieitlvksekfdelmaaa
SCOPe Domain Coordinates for d1vm0a_:
Click to download the PDB-style file with coordinates for d1vm0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vm0a_:
- d1vm0a_ first appeared in SCOP 1.69
- d1vm0a_ appears in SCOPe 2.07
View in 3D
