Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.250: Folate-binding domain [103024] (1 superfamily) duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands |
Superfamily d.250.1: Folate-binding domain [103025] (2 families) some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase |
Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins) |
Protein Glycine cleavage system T protein, GcvT [111012] (4 species) |
Species Escherichia coli [TaxId:562] [111014] (1 PDB entry) Uniprot P27248 |
Domain d1vloa2: 1vlo A:4-277 [108839] Other proteins in same PDB: d1vloa1, d1vloa3 Structural genomics target |
PDB Entry: 1vlo (more details), 1.7 Å
SCOPe Domain Sequences for d1vloa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vloa2 d.250.1.1 (A:4-277) Glycine cleavage system T protein, GcvT {Escherichia coli [TaxId: 562]} qtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfdvshmtivdlrgsrtr eflryllandvakltksgkalysgmlnasggviddlivyyftedffrlvvnsatrekdls witqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqavegmkpffgvqagdlf iattgytgeagyeialpnekaadfwralveagvkpcglgardtlrleagmnlygqemdet isplaanmgwtiawepadrdfigrealevqrehg
Timeline for d1vloa2: