Lineage for d1vl9a_ (1vl9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015628Protein Phospholipase A2 [48637] (5 species)
  7. 2015629Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (32 PDB entries)
    Uniprot P00593
  8. 2015631Domain d1vl9a_: 1vl9 A: [113665]
    complexed with ca, cl, mpd, mrd; mutant

Details for d1vl9a_

PDB Entry: 1vl9 (more details), 0.97 Å

PDB Description: atomic resolution (0.97a) structure of the triple mutant (k53,56,121m) of bovine pancreatic phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1vl9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl9a_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
mnc

SCOPe Domain Coordinates for d1vl9a_:

Click to download the PDB-style file with coordinates for d1vl9a_.
(The format of our PDB-style files is described here.)

Timeline for d1vl9a_: