Lineage for d1vl6a1 (1vl6 A:155-376)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845309Protein Malate oxidoreductase (malic enzyme) [110434] (1 species)
  7. 2845310Species Thermotoga maritima [TaxId:2336] [110435] (1 PDB entry)
    Uniprot Q9WZ12
  8. 2845311Domain d1vl6a1: 1vl6 A:155-376 [108724]
    Other proteins in same PDB: d1vl6a2, d1vl6a3, d1vl6b2, d1vl6b3, d1vl6c2, d1vl6c3, d1vl6d2, d1vl6d3
    Structural genomics target
    has additional insertions and/or extensions that are not grouped together

Details for d1vl6a1

PDB Entry: 1vl6 (more details), 2.61 Å

PDB Description: Crystal structure of NAD-dependent malic enzyme (TM0542) from Thermotoga maritima at 2.61 A resolution
PDB Compounds: (A:) Malate oxidoreductase

SCOPe Domain Sequences for d1vl6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyhleiaritnperlsgdletalegadffigvsrgnilkpewikkmsr
kpvifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitk
nmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa

SCOPe Domain Coordinates for d1vl6a1:

Click to download the PDB-style file with coordinates for d1vl6a1.
(The format of our PDB-style files is described here.)

Timeline for d1vl6a1: