Lineage for d1vl0b_ (1vl0 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347141Protein DTDP-4-dehydrorhamnose reductase RfbD [110409] (1 species)
  7. 1347142Species Clostridium acetobutylicum [TaxId:1488] [110410] (1 PDB entry)
    Uniprot Q97GQ1
  8. 1347144Domain d1vl0b_: 1vl0 B: [108705]
    Structural genomics target
    complexed with nai, unl

Details for d1vl0b_

PDB Entry: 1vl0 (more details), 2.05 Å

PDB Description: crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution
PDB Compounds: (B:) DTDP-4-dehydrorhamnose reductase, rfbD ortholog

SCOPe Domain Sequences for d1vl0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl0b_ c.2.1.2 (B:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}
mkilitgangqlgreiqkqlkgknveviptdvqdlditnvlavnkffnekkpnvvincaa
htavdkceeqydlaykinaigpknlaaaaysvgaeivqistdyvfdgeakepitefdevn
pqsaygktklegenfvkalnpkyyivrtawlygdgnnfvktminlgkthdelkvvhdqvg
tptstvdlarvvlkvideknygtfhctckgicswydfaveifrltgidvkvtpctteefp
rpakrpkysvlrnymlelttgditrewkeslkeyidllqm

SCOPe Domain Coordinates for d1vl0b_:

Click to download the PDB-style file with coordinates for d1vl0b_.
(The format of our PDB-style files is described here.)

Timeline for d1vl0b_: