| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.4: NADH pyrophosphatase [103214] (1 protein) duplication: consists of two structurally similar domains separated by a rubredoxin-like zinc finger; the N-terminal domain has a rudiment Nudix fold, the C-terminal, probably catalytic, domain has the canonical fold |
| Protein NADH pyrophosphatase [103215] (1 species) |
| Species Escherichia coli [TaxId:562] [103216] (2 PDB entries) |
| Domain d1vk6a2: 1vk6 A:126-256 [100852] Other proteins in same PDB: d1vk6a4, d1vk6a5 structural genomics complexed with mpd, zn |
PDB Entry: 1vk6 (more details), 2.2 Å
SCOPe Domain Sequences for d1vk6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}
qiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmeesgikvkn
lryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgtvarrli
edtvamcraey
Timeline for d1vk6a2: