Lineage for d1vk6a2 (1vk6 A:126-256)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971733Family d.113.1.4: NADH pyrophosphatase [103214] (1 protein)
    duplication: consists of two structurally similar domains separated by a rubredoxin-like zinc finger; the N-terminal domain has a rudiment Nudix fold, the C-terminal, probably catalytic, domain has the canonical fold
  6. 2971734Protein NADH pyrophosphatase [103215] (1 species)
  7. 2971735Species Escherichia coli [TaxId:562] [103216] (2 PDB entries)
  8. 2971740Domain d1vk6a2: 1vk6 A:126-256 [100852]
    Other proteins in same PDB: d1vk6a4, d1vk6a5
    structural genomics
    complexed with mpd, zn

Details for d1vk6a2

PDB Entry: 1vk6 (more details), 2.2 Å

PDB Description: crystal structure of nadh pyrophosphatase (1790429) from escherichia coli k12 at 2.20 a resolution
PDB Compounds: (A:) NADH pyrophosphatase

SCOPe Domain Sequences for d1vk6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]}
qiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmeesgikvkn
lryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgtvarrli
edtvamcraey

SCOPe Domain Coordinates for d1vk6a2:

Click to download the PDB-style file with coordinates for d1vk6a2.
(The format of our PDB-style files is described here.)

Timeline for d1vk6a2: