Lineage for d1vk3a4 (1vk3 A:508-603)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734160Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 734161Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 734162Family d.139.1.1: PurM C-terminal domain-like [56043] (4 proteins)
  6. 734173Protein Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 [103260] (1 species)
    duplication: tandem repeats of two PurM-like units arranged like the PurM subunits in the dimer
  7. 734174Species Thermotoga maritima [TaxId:2336] [103261] (6 PDB entries)
    TM1246
  8. 734176Domain d1vk3a4: 1vk3 A:508-603 [100849]
    Other proteins in same PDB: d1vk3a1, d1vk3a2
    structural genomics
    complexed with cl

Details for d1vk3a4

PDB Entry: 1vk3 (more details), 2.15 Å

PDB Description: Crystal structure of Phosphoribosylformylglycinamidine synthase II (TM1246) from Thermotoga maritima at 2.15 A resolution
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase II

SCOP Domain Sequences for d1vk3a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk3a4 d.139.1.1 (A:508-603) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
akpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthvetfreyglki
evklpevrpahqmvlvfsertpvvdvpvkeigtlsr

SCOP Domain Coordinates for d1vk3a4:

Click to download the PDB-style file with coordinates for d1vk3a4.
(The format of our PDB-style files is described here.)

Timeline for d1vk3a4: