Lineage for d1vj3a_ (1vj3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511237Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)
  8. 2511261Domain d1vj3a_: 1vj3 A: [100798]
    complexed with ndp, tab

Details for d1vj3a_

PDB Entry: 1vj3 (more details), 2.1 Å

PDB Description: structural studies on bio-active compounds. crystal structure and molecular modeling studies on the pneumocystis carinii dihydrofolate reductase cofactor complex with tab, a highly selective antifolate.
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1vj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vj3a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
gtkvphgkinedgfdyefemwtrdl

SCOPe Domain Coordinates for d1vj3a_:

Click to download the PDB-style file with coordinates for d1vj3a_.
(The format of our PDB-style files is described here.)

Timeline for d1vj3a_: