![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins) |
![]() | Protein R67 dihydrofolate reductase [50092] (1 species) |
![]() | Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (2 PDB entries) |
![]() | Domain d1viea_: 1vie A: [24592] |
PDB Entry: 1vie (more details), 1.7 Å
SCOPe Domain Sequences for d1viea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1viea_ b.34.4.1 (A:) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1 [TaxId: 562]} psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin
Timeline for d1viea_: