Lineage for d1viea_ (1vie A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783742Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins)
  6. 2783743Protein R67 dihydrofolate reductase [50092] (1 species)
  7. 2783744Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (2 PDB entries)
  8. 2783745Domain d1viea_: 1vie A: [24592]

Details for d1viea_

PDB Entry: 1vie (more details), 1.7 Å

PDB Description: structure of dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1viea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1viea_ b.34.4.1 (A:) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1 [TaxId: 562]}
psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

SCOPe Domain Coordinates for d1viea_:

Click to download the PDB-style file with coordinates for d1viea_.
(The format of our PDB-style files is described here.)

Timeline for d1viea_: