Lineage for d1vhva_ (1vhv A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
consists of two non-similar domains
Domain 1 has parallel sheet of 5 strands, order 32415
Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the restSuperfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) 
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
Pfam PF00590Protein Diphthine synthase, DphB [102684] (3 species)
diphthamide biosynthesis methyltransferase
Species Archaeoglobus fulgidus [TaxId:2234] [102685] (1 PDB entry) 
Domain d1vhva_: 1vhv A: [100704]
Details for d1vhva_
PDB Entry: 1vhv (more details), 1.75 Å
PDB Description: crystal structure of diphthine synthase
PDB Compounds: (A:) diphthine synthaseSCOPe Domain Sequences for d1vhva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhva_ c.90.1.1 (A:) Diphthine synthase, DphB {Archaeoglobus fulgidus [TaxId: 2234]}
slltfvglglwdvkdisvkgleavreadevyveyytskllssieemeeffgkrvvelers
dleensfrlieraksksvvllvpgdpmvatthsaikleaerkgvktriihgasistavcg
ltglhnyrfgksatvswhrsqtpvnvikanrsidahtllfldlhpepmtighavenliae
daqmkdlyavgiaragsgeevvkcdrlenlkkidfgkplhvmvvlaktlhfmefeclref
adapaelerlv
SCOPe Domain Coordinates for d1vhva_:
Click to download the PDB-style file with coordinates for d1vhva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vhva_:
- d1vhva_ first appeared in SCOP 1.67
- d1vhva_ appears in SCOPe 2.04
- d1vhva_ is called d1vhva1 in SCOPe 2.06
- d1vhva_ appears in the current release, SCOPe 2.08, called d1vhva1
View in 3D
