Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) can form closed, open and helix-swapped bundles |
Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein) automatically mapped to Pfam PF02561 |
Protein Flagellar export chaperone FliS [101118] (2 species) |
Species Bacillus subtilis [TaxId:1423] [101120] (1 PDB entry) |
Domain d1vh6b_: 1vh6 B: [100645] structural genomics; swapped dimer |
PDB Entry: 1vh6 (more details), 2.5 Å
SCOPe Domain Sequences for d1vh6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vh6b_ a.24.19.1 (B:) Flagellar export chaperone FliS {Bacillus subtilis [TaxId: 1423]} vntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrniel sasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqse
Timeline for d1vh6b_: