Lineage for d1vh0a_ (1vh0 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1188485Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1188486Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1188518Family c.116.1.3: YbeA-like [82371] (5 proteins)
    Pfam PF02590
  6. 1188519Protein Hypothetical protein SAV0024/SA0023 [102276] (1 species)
  7. 1188520Species Staphylococcus aureus [TaxId:1280] [102277] (1 PDB entry)
  8. 1188521Domain d1vh0a_: 1vh0 A: [100626]
    structural genomics

Details for d1vh0a_

PDB Entry: 1vh0 (more details), 2.31 Å

PDB Description: crystal structure of a hypothetical protein
PDB Compounds: (A:) Hypothetical UPF0247 protein SAV0024/SA0023

SCOPe Domain Sequences for d1vh0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh0a_ c.116.1.3 (A:) Hypothetical protein SAV0024/SA0023 {Staphylococcus aureus [TaxId: 1280]}
lkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvkekeg
qrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkdvlqr
snyalsfskmtfphqmmrvvlieqvyrafkimrgeay

SCOPe Domain Coordinates for d1vh0a_:

Click to download the PDB-style file with coordinates for d1vh0a_.
(The format of our PDB-style files is described here.)

Timeline for d1vh0a_: