Lineage for d1vgma_ (1vgm A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.103: Citrate synthase [48255] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.103.1: Citrate synthase [48256] (2 families) 
Family a.103.1.1: Citrate synthase [48257] (2 proteins)
duplication: large domain consists of two structural repeats
the second repeat is interrupted by the small domain
automatically mapped to Pfam PF00285Protein automated matches [190675] (10 species)
not a true protein
Species Sulfolobus tokodaii [TaxId:111955] [188060] (1 PDB entry) 
Domain d1vgma_: 1vgm A: [161861]
automated match to d1o7xc_
complexed with gol, so4
Details for d1vgma_
PDB Entry: 1vgm (more details), 2 Å
PDB Description: crystal structure of an isozyme of citrate synthase from sulfolbus tokodaii strain7
PDB Compounds: (A:) 378aa long hypothetical citrate synthaseSCOPe Domain Sequences for d1vgma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgma_ a.103.1.1 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
vevsrglenviikttgltyidgingilryrgydindlvnyasyeelihlmlygelpnrqq
lnqikgiinesfevpeqvistifsmprncdaigmmetafgilasiydpkwnratnkelav
qiiaktatitaniyrakeglkpkipepsesyaesflaatfgkkptqeeikamdaslilyt
dhevpasttaalvasstlsdmyscivaalaalkgplhggaaeeafkqfveigsvenadkw
feekiikgksrlmgfghrvyktydprakifktlaksfaeknenvkkyyeiaerieklgvd
tfgskhiypntdfysgivfyalgfpiymftslfalsrvlgwlahiieyveeqhrlirpra
lyigpekrefkpielr
SCOPe Domain Coordinates for d1vgma_:
Click to download the PDB-style file with coordinates for d1vgma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vgma_:
- d1vgma_ first appeared in SCOPe 2.01
- d1vgma_ appears in SCOPe 2.06
- d1vgma_ appears in the current release, SCOPe 2.08
View in 3D
