Lineage for d1vgka2 (1vgk A:1-181)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) 
Species Mouse (Mus musculus), H-2KD [TaxId:10090] [160078] (4 PDB entries)
Uniprot P01902 22-202
Domain d1vgka2: 1vgk A:1-181 [144408]
Other proteins in same PDB: d1vgka1, d1vgkb_
automatically matched to 2FWO A:1-181
Details for d1vgka2
PDB Entry: 1vgk (more details), 2.06 Å
PDB Description: The crystal structure of class I Major histocompatibility complex, H-2Kd at 2.0 A resolution
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chainSCOPe Domain Sequences for d1vgka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KD [TaxId: 10090]}
gphslryfvtavsrpglgeprfiavgyvddtqfvrfdsdadnprfeprapwmeqegpeyw
eeqtqraksdeqwfrvslrtaqryynqskggshtfqrmfgcdvgsdwrllrgyqqfaydg
rdyialnedlktwtaadtaalitrrkweqagdaeyyraylegecvewlrrylelgnetll
r
SCOPe Domain Coordinates for d1vgka2:
Click to download the PDB-style file with coordinates for d1vgka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vgka2:
- d1vgka2 first appeared in SCOP 1.75
- d1vgka2 appears in SCOPe 2.07
View in 3D
