Lineage for d1veza_ (1vez A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.167: Peptide deformylase [56419] (1 superfamily)
alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helixSuperfamily d.167.1: Peptide deformylase [56420] (2 families) 
nickel-dependent enzymeFamily d.167.1.1: Peptide deformylase [56421] (2 proteins)
automatically mapped to Pfam PF01327Protein Peptide deformylase [56422] (11 species) 
Species Leptospira interrogans [TaxId:173] [103340] (5 PDB entries)
Uniprot Q72S74
Domain d1veza_: 1vez A: [161854]
automated match to d1y6ha_
complexed with fmt, trs, zn
Details for d1veza_
PDB Entry: 1vez (more details), 2.3 Å
PDB Description: Crystal Structure of Peptide Deformylase from Leptospira Interrogans(LiPDF) at pH8.0
PDB Compounds: (A:) Peptide deformylaseSCOPe Domain Sequences for d1veza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veza_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldss
SCOPe Domain Coordinates for d1veza_:
Click to download the PDB-style file with coordinates for d1veza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1veza_:
- d1veza_ first appeared in SCOPe 2.01
- d1veza_ appears in SCOPe 2.07
View in 3D
