Lineage for d1vefa1 (1vef A:9-395)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
formerly omega-Aminoacid:pyruvate aminotransferase-like
Protein Acetylornithine/acetyl-lysine aminotransferase ArgD [142674] (1 species) Species Thermus thermophilus [TaxId:274] [142675] (3 PDB entries)
Uniprot Q93R93 9-395
Domain d1vefa1: 1vef A:9-395 [120018]
complexed with plp
Details for d1vefa1
PDB Entry: 1vef (more details), 1.35 Å
PDB Description: Acetylornithine aminotransferase from Thermus thermophilus HB8
PDB Compounds: (A:) Acetylornithine/acetyl-lysine aminotransferaseSCOPe Domain Sequences for d1vefa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]}
wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggygvanlghgnpevve
avkrqaetlmampqtlptpmrgefyrtltailppelnrvfpvnsgteaneaalkfaraht
grkkfvaamrgfsgrtmgslsvtwepkyrepflplvepvefipyndvealkravdeetaa
vilepvqgeggvrpatpeflraareitqekgallildeiqtgmgrtgkrfafehfgivpd
iltlakalgggvplgvavmreevarsmpkgghgttfggnplamaagvaairylertrlwe
raaelgpwfmeklraipspkirevrgmglmvglelkekaapyiarlekehrvlalqagpt
virflpplviekedlervveavravla
SCOPe Domain Coordinates for d1vefa1:
Click to download the PDB-style file with coordinates for d1vefa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vefa1:
- d1vefa1 first appeared in SCOP 1.73
- d1vefa1 appears in SCOPe 2.07
View in 3D
