Lineage for d1ve2a1 (1ve2 A:1-235)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
consists of two non-similar domains
Domain 1 has parallel sheet of 5 strands, order 32415
Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the restSuperfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) 
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
Pfam PF00590
Protein Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) [117736] (2 species) Species Thermus thermophilus [TaxId:274] [142780] (1 PDB entry)
Uniprot Q53WA2 1-235
Domain d1ve2a1: 1ve2 A:1-235 [120008]
Other proteins in same PDB: d1ve2b_
Details for d1ve2a1
PDB Entry: 1ve2 (more details), 1.8 Å
PDB Description: Crystal structure of uroporphyrin-III-C-methyltransferase from thermus thermophilus
PDB Compounds: (A:) Uroporphyrin-III C-methyltransferaseSCOPe Domain Sequences for d1ve2a1:
Sequence, based on SEQRES records: (download)
>d1ve2a1 c.90.1.1 (A:1-235) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Thermus thermophilus [TaxId: 274]}
mrgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvgkegygg
ktpqeaitarlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavg
alsalglplthrglarsfavatghdpalplpradtlvllmplhtlgglkerllerfppet
plallarvgwpgeavrlgrvedlpglgeglpspallvvgkvvglygellpkdhgl
Sequence, based on observed residues (ATOM records): (download)
>d1ve2a1 c.90.1.1 (A:1-235) Uroporphyrin-III C-methyltransferase (SUMT, UROM, CobA) {Thermus thermophilus [TaxId: 274]}
mrgkvylvgagfggpehltlkalrvlevaevvlhdrlvhpgvlalakgelvpvktpqeai
tarlialaregrvvarlkggdpmvfgrggeealalrragipfevvpgvtsavgalsalgl
plthrglarsfavatghdpalplpradtlvllmglkerllerfppetplallarvgwpge
avrlgrvedlpglgeglpspallvvgkvvglygellpkdhgl
SCOPe Domain Coordinates for d1ve2a1:
Click to download the PDB-style file with coordinates for d1ve2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ve2a1:
- d1ve2a1 first appeared in SCOP 1.73
- d1ve2a1 appears in SCOPe 2.07
View in 3D
