![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142743] (1 PDB entry) Uniprot Q5SLE6 1-302 |
![]() | Domain d1ve1a1: 1ve1 A:1-302 [120007] complexed with plp |
PDB Entry: 1ve1 (more details), 1.45 Å
SCOPe Domain Sequences for d1ve1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl ya
Timeline for d1ve1a1: