Lineage for d1vdrb_ (1vdr B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153746Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 2153863Species Haloferax volcanii [TaxId:2246] [53604] (3 PDB entries)
  8. 2153865Domain d1vdrb_: 1vdr B: [34894]
    CASP2
    complexed with po4

Details for d1vdrb_

PDB Entry: 1vdr (more details), 2.55 Å

PDB Description: dihydrofolate reductase
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1vdrb_:

Sequence, based on SEQRES records: (download)

>d1vdrb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]}
elvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsaq
ivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsrv
pgeyegdtyypewdaaeweldaetdhegftlqewvrsa

Sequence, based on observed residues (ATOM records): (download)

>d1vdrb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]}
elvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsaq
ivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsrv
pegdtyypewdaaeweldaetdhegftlqewvrsa

SCOPe Domain Coordinates for d1vdrb_:

Click to download the PDB-style file with coordinates for d1vdrb_.
(The format of our PDB-style files is described here.)

Timeline for d1vdrb_: